DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and Prss29

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:271 Identity:79/271 - (29%)
Similarity:128/271 - (47%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GCGITSRQFP-------RLTGGRPAEPDEWPWMAALLQEGLPFVW------CGGVLITDRHVLTA 214
            ||.|.....|       .:.||..|...:|||..:|  ....:.|      |||.:|..:.||||
Mouse    13 GCSIAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSL--RIYRYYWAFWVHNCGGSIIHPQWVLTA 75

  Fly   215 AHCIYKKNKE-DIF-VRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIF 277
            ||||.:::.: .:| :|:||...:...|.    ..::.:::|.|:......:|:|::::..:...
Mouse    76 AHCIRERDADPSVFRIRVGEAYLYGGKEL----LSVSRVIIHPDFVHAGLGSDVALLQLAVSVQS 136

  Fly   278 NTYIWPVCMPPVNEDWSDRNAI-VTGWGTQKFGGPHSNI-----LMEVNLPVWKQSDCRSSF--- 333
            ...:.||.:|..:.:.:.::.. |||||..   ..|.::     |.:|.:.:...|.|...:   
Mouse   137 FPNVKPVKLPSESLEVTKKDVCWVTGWGAV---STHRSLPPPYRLQQVQVKIIDNSLCEEMYHNA 198

  Fly   334 VQH-------VPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGI 391
            .:|       :....:|||  ..|||||.|||||||:..:... |..:|:||||.||..|..||:
Mouse   199 TRHRNRGQKLILKDMLCAG--NQGQDSCYGDSGGPLVCNVTGS-WTLVGVVSWGYGCALRDFPGV 260

  Fly   392 YTRVDRYLDWI 402
            |.||..:|.||
Mouse   261 YARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 73/252 (29%)
Tryp_SPc 176..402 CDD:238113 73/249 (29%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 75/253 (30%)
Tryp_SPc 31..271 CDD:214473 73/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.