DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and LOC108647852

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:277 Identity:91/277 - (32%)
Similarity:141/277 - (50%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 FSPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAA---LLQEGLPFVWC 201
            ||...:....|..|.:.|....|          |:..|...||..|||||:   |.::|.... |
 Frog    20 FSENSILKTCGIRPLVKNHHRVR----------RVIEGNTPEPGSWPWMASIQLLYKDGYGSA-C 73

  Fly   202 GGVLITDRHVLTAAHCI--YKKNKEDIFVRLGEYN-THMLNETRARDFRIANMVLHIDYNPQNYD 263
            ||||:::|.|:|||||:  .|:.:....:.||..: |.:..||:.|  .|...:.|.|::.:.:.
 Frog    74 GGVLLSNRWVVTAAHCLSDLKRYRHLARIVLGARDLTQLGPETQIR--TIKQWIQHEDFDHKTHK 136

  Fly   264 NDIAIVRIDRATIFNTYIWPVCMPPVNED-WSDRNAIVTGWG--TQKFGGPH--SNILMEVNLPV 323
            ||||::|::....|:.||.|.|:||.:.: :...:..:.|||  .:|   |.  :.:|.|..:.:
 Frog   137 NDIALIRLNYPVKFSDYIQPACLPPKSSNVYKMDDCHIAGWGLLNEK---PRTVTTMLQEATVEL 198

  Fly   324 WKQSDCRSS--FVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQR-WVTIGIVSWGVGCGQ 385
            ..:..|.||  :...:.|..:|||:.:||.|.|.|||||||:.:..... :..:||||||..|||
 Frog   199 IDRKRCNSSDWYNGGIHDDNLCAGYEQGGPDVCMGDSGGPLMCKRKKAGIYYVVGIVSWGGLCGQ 263

  Fly   386 RGRPGIYTRVDRYLDWI 402
            ....|:||.|..:..||
 Frog   264 PHSNGVYTSVQDFEQWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 83/242 (34%)
Tryp_SPc 176..402 CDD:238113 82/239 (34%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 82/241 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.