DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and f7l

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:414 Identity:125/414 - (30%)
Similarity:179/414 - (43%) Gaps:90/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FLSQHRLNKRQAP----TSQLLENKDYG----ACSTPLGESGRCRHIIYCRMPELKNDVWRLVSQ 118
            |||:...|:...|    .:..||....|    .|...:......|.|.  .:|:...|.|:..::
Zfish    30 FLSRAEANRPLHPRVRRANSFLEELKLGDLERECLEEICSYEEAREIF--TVPDQLEDFWKRYTE 92

  Fly   119 L--CIIEKSSIGICCTDQSTS---------------NRFSPQ----------------VVTS--- 147
            :  |..|....|..|.||..:               ...||:                |.||   
Zfish    93 VDHCQSEPCQNGATCVDQINTYICICPVNLEGRHCDKEISPRSSFGCLYRNGGCEHFCVETSETT 157

  Fly   148 -----ADG-----DEPRIV-------NKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEG 195
                 |.|     |....|       .:|..:|.|      ||:..|......:.||.|.|..:|
Zfish   158 HSCDCAPGYTLHSDNSSCVPTADFSCGRPVAKGVG------PRIVKGDVCPKGQCPWQALLEYDG 216

  Fly   196 LPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARD------FRIANMVLH 254
            .  ..||||::..:.::||||||::|:...:.|.:||:       .|.||      .:::.:.||
Zfish   217 Q--YKCGGVILNSQWIITAAHCIWRKDPALLQVIVGEH-------IRDRDEGTEQMRKVSEVFLH 272

  Fly   255 IDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSD-----RNAIVTGWGTQKFGGPHSN 314
            ..||..:.|:|:|::|:.|......|..|||:||.|..:|.     |.:.|:|||.....||.|.
Zfish   273 PQYNHSSTDSDVALLRLHRPVTLGPYALPVCLPPPNGTFSRTLASIRMSTVSGWGRLAQSGPPST 337

  Fly   315 ILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSW 379
            :|..:.:|.....|||:.....|....:||||.|||:|||||||||||:.:..| .|...|||||
Zfish   338 VLQRLQVPRVSSEDCRARSGLTVSRNMLCAGFAEGGRDSCQGDSGGPLVTRYRN-TWFLTGIVSW 401

  Fly   380 GVGCGQRGRPGIYTRVDRYLDWIL 403
            |.||.:....||||||..:::|||
Zfish   402 GKGCARADVYGIYTRVSVFVEWIL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829 9/46 (20%)
Tryp_SPc 173..402 CDD:214473 89/239 (37%)
Tryp_SPc 176..402 CDD:238113 88/236 (37%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245876at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6487
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.