DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9372 and zgc:163079

DIOPT Version :9

Sequence 1:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:244 Identity:75/244 - (30%)
Similarity:118/244 - (48%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEY---- 233
            ::.||..|....|||.|::..:.....:|||.||....|||.|.........||.|.||..    
Zfish    35 KIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNG 99

  Fly   234 -NTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRN 297
             |.:.::.|      :..::.|.:||  :.|:::|::::.....|:.||.|||:......:.|..
Zfish   100 SNPYEISRT------VTKIIKHPNYN--SLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDGT 156

  Fly   298 AI-VTGWG-------TQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGF-PEGGQDS 353
            |. |||||       .::...|  ::|.||..|:....:|.:::...:.:..:|||: .|.|:..
Zfish   157 ASWVTGWGYLNRPATVEEIMLP--DVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLNEDGKAP 219

  Fly   354 CQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402
            |.||.||||::: ....|:..|:|..|. ||..|.|.||.||..|.|||
Zfish   220 CAGDVGGPLVIK-QGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 73/242 (30%)
Tryp_SPc 176..402 CDD:238113 73/239 (31%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 73/242 (30%)
Tryp_SPc 36..267 CDD:238113 75/243 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587644
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.