DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lush and C35A11.2

DIOPT Version :9

Sequence 1:NP_001163468.1 Gene:lush / 40136 FlyBaseID:FBgn0020277 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_504429.2 Gene:C35A11.2 / 183227 WormBaseID:WBGene00016429 Length:202 Species:Caenorhabditis elegans


Alignment Length:153 Identity:33/153 - (21%)
Similarity:51/153 - (33%) Gaps:48/153 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQVLVLLLPDPAVAMTMEQFLTSLDMIRSGCAPKFKLKTEDLD-RLRVGDFNFPPSQDLMCYTKC 79
            :|:.||.:          .||..|.::..|     |:..|.|| :|..|          |.:..|
 Worm     1 MQLSVLFI----------AFLHQLVVVSDG-----KVTAEQLDKKLGAG----------MKHVSC 40

  Fly    80 VSLMAGTVNK---KGEFNAP-------------KALAQL-----PHLVPPEMMEMSRKSVEACRD 123
            ...:.|...|   |..||..             |.:|:|     |...|.|:.:......:.|.|
 Worm    41 QMRITGFYMKRHCKKHFNTTLRCDLNEHERRTVKKVAKLCCEDAPSCEPTELFDEFCCQGDHCED 105

  Fly   124 TH-KQFKESCERVYQTAKCFSEN 145
            |. ..:.:|.|.:......||.:
 Worm   106 TECHPWDDSVEEIQLANLVFSSD 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lushNP_001163468.1 PhBP 42..145 CDD:214783 27/125 (22%)
C35A11.2NP_504429.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.