DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ash1 and SET3

DIOPT Version :9

Sequence 1:NP_001246834.1 Gene:ash1 / 40133 FlyBaseID:FBgn0005386 Length:2226 Species:Drosophila melanogaster
Sequence 2:NP_012954.3 Gene:SET3 / 853900 SGDID:S000001737 Length:751 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:78/315 - (24%)
Similarity:120/315 - (38%) Gaps:90/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1769 EGKEKALQSLK-----------DSYEQQKIASYVQLVEILGDSESLQSFKPKEVLSSEEEPGKIA 1822
            :||::|.::.|           :|:|::|..:.......|..:.:: |...|:  ::|:...:.|
Yeast    23 KGKKRAEEASKIGSKTDTIEHDESHEREKKGAIEMAAAALATASTV-SLPLKK--ATEQSAAEAA 84

  Fly  1823 VKKSPGAKERDSPIVPLKVTPPPLLPIEAS----PDEDVIRCICGLYKDEGLMIQCSKCMVWQHT 1883
            .  |..||| ::...|.|   .|..|:..|    ||..:|.|||.|..|:|..|||..|..|||.
Yeast    85 T--STAAKE-ETENQPQK---QPQWPVPDSYIVDPDAGIITCICDLNDDDGFTIQCDHCNRWQHA 143

  Fly  1884 EC---TKADIDADNYQCERCEPREVD----REIPLEEFT----------------EEGHRYYLSL 1925
            .|   ....:..|:|.|..|:|||||    |:|..|...                ..|.....|.
Yeast   144 ICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVKTVEPSSSNNSASNKNNGRDRASST 208

  Fly  1926 MRGDLQVRQGDAVYVLRD-----------------IPIKDESGKV--------LPTKKHTY---- 1961
            ...|:    ||:....:|                 |..|:||..|        :|.||..:    
Yeast   209 TISDV----GDSFSTDQDNTNHRDKRRKRNPSNNSIDSKNESASVNSSDGLTSMPKKKEHFLSAK 269

  Fly  1962 ETIGAIDYQECDIFRVEHLWKNELGKRFIFGHH-----FLRPHETFHEPSRRFYP 2011
            :..|||.....|     :::|::|.:.|:..|.     ...||:||...|....|
Yeast   270 DAYGAIYLPLKD-----NVFKSDLIEPFLNKHMDDNWVIQYPHKTFKSVSIEVKP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ash1NP_001246834.1 AWS 1340..1388 CDD:197795
SET 1392..1512 CDD:214614
Bromo_ASH1 1680..1787 CDD:99955 6/28 (21%)
PHD_ASH1L 1858..1900 CDD:277023 18/44 (41%)
BAH_polybromo 1929..2073 CDD:240068 26/117 (22%)
SET3NP_012954.3 PHD_MLL5 119..163 CDD:277025 17/43 (40%)
SET 217..722 CDD:225491 23/108 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.