DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ash1 and SDG4

DIOPT Version :9

Sequence 1:NP_001246834.1 Gene:ash1 / 40133 FlyBaseID:FBgn0005386 Length:2226 Species:Drosophila melanogaster
Sequence 2:NP_567859.1 Gene:SDG4 / 829210 AraportID:AT4G30860 Length:497 Species:Arabidopsis thaliana


Alignment Length:268 Identity:88/268 - (32%)
Similarity:127/268 - (47%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1282 YCEKYLRRTEMDFELPYDIWWAYTNSKLPTRNVV----PSWNYRKIRTNVY-AESVRPNLAGFDH 1341
            :|:..|...|.:|::  |:.|        ..:||    ||  |..||.|:| .:..|.|.    :
plant   234 FCQLPLPYVEEEFKI--DLAW--------KDSVVKEDPPS--YVHIRRNIYLVKKKRDNA----N 282

  Fly  1342 PTCNCKNQGEKSCLDNCLNRMVYTECSPSNCPAGEKCRNQKIQRHAVAPGVERFMTADKGWGVRT 1406
            ....|.|.| .:|..:|:.|:....|| ..|...|.|.|:..::.   ..::...|...||||..
plant   283 DGVGCTNCG-PNCDRSCVCRVQCISCS-KGCSCPESCGNRPFRKE---KKIKIVKTEHCGWGVEA 342

  Fly  1407 KLPIAKGTYILEYVGEVVTEKEFKQRMASIYLNDTHH------YCLHLDGGLVIDGQRMGSDCRF 1465
            ...|.|..:|:||:|||:::.:.:||     |.|..|      |...:.....||....|:..||
plant   343 AESINKEDFIVEYIGEVISDAQCEQR-----LWDMKHKGMKDFYMCEIQKDFTIDATFKGNASRF 402

  Fly  1466 VNHSCEPNCEMQKWSVNGLSRMVLFAKRAIEEGEELTYDYNFSLFNPSEGQPCRCNTPQCRGVIG 1530
            :||||.|||.::||.|.|.:|:.:||.|.||.||.|||||.|..|.|.  ..|.|.:..|:|.:|
plant   403 LNHSCNPNCVLEKWQVEGETRVGVFAARQIEAGEPLTYDYRFVQFGPE--VKCNCGSENCQGYLG 465

  Fly  1531 GKSQRVKP 1538
            .|  |.:|
plant   466 TK--RKEP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ash1NP_001246834.1 AWS 1340..1388 CDD:197795 12/47 (26%)
SET 1392..1512 CDD:214614 50/125 (40%)
Bromo_ASH1 1680..1787 CDD:99955
PHD_ASH1L 1858..1900 CDD:277023
BAH_polybromo 1929..2073 CDD:240068
SDG4NP_567859.1 PHD2_NSD 121..167 CDD:277040
AWS 286..326 CDD:197795 12/44 (27%)
SET 326..449 CDD:214614 50/127 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.