DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ash1 and SPCC645.13

DIOPT Version :9

Sequence 1:NP_001246834.1 Gene:ash1 / 40133 FlyBaseID:FBgn0005386 Length:2226 Species:Drosophila melanogaster
Sequence 2:NP_001342882.1 Gene:SPCC645.13 / 2538700 PomBaseID:SPCC645.13 Length:721 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:26/72 - (36%)
Similarity:37/72 - (51%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1853 PDEDVIRCICGLYKDEG-LMIQCSKCMVWQHTECT-KADID-ADNYQCERCEPR-EVDREIPLEE 1913
            |.|.|:||:|...:|.| ..:||..|..|||..|. .||.| .::|.||.|..| :|..::....
pombe    16 PPETVVRCVCKSQEDIGDTWVQCDGCDCWQHASCVGLADKDIPESYYCEVCHSRSDVSSQVQNSP 80

  Fly  1914 FTEEGHR 1920
            ..:|.|:
pombe    81 NKDEEHQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ash1NP_001246834.1 AWS 1340..1388 CDD:197795
SET 1392..1512 CDD:214614
Bromo_ASH1 1680..1787 CDD:99955
PHD_ASH1L 1858..1900 CDD:277023 18/44 (41%)
BAH_polybromo 1929..2073 CDD:240068
SPCC645.13NP_001342882.1 PHD_SF 22..66 CDD:328929 18/43 (42%)
TFS2M 215..330 CDD:128786
SPOC 474..624 CDD:311609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.