powered by:
Protein Alignment ash1 and SPCC645.13
DIOPT Version :9
Sequence 1: | NP_001246834.1 |
Gene: | ash1 / 40133 |
FlyBaseID: | FBgn0005386 |
Length: | 2226 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001342882.1 |
Gene: | SPCC645.13 / 2538700 |
PomBaseID: | SPCC645.13 |
Length: | 721 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 37/72 - (51%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1853 PDEDVIRCICGLYKDEG-LMIQCSKCMVWQHTECT-KADID-ADNYQCERCEPR-EVDREIPLEE 1913
|.|.|:||:|...:|.| ..:||..|..|||..|. .||.| .::|.||.|..| :|..::....
pombe 16 PPETVVRCVCKSQEDIGDTWVQCDGCDCWQHASCVGLADKDIPESYYCEVCHSRSDVSSQVQNSP 80
Fly 1914 FTEEGHR 1920
..:|.|:
pombe 81 NKDEEHQ 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4489 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.