DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ash1 and set-12

DIOPT Version :9

Sequence 1:NP_001246834.1 Gene:ash1 / 40133 FlyBaseID:FBgn0005386 Length:2226 Species:Drosophila melanogaster
Sequence 2:NP_509306.2 Gene:set-12 / 187229 WormBaseID:WBGene00019584 Length:389 Species:Caenorhabditis elegans


Alignment Length:320 Identity:90/320 - (28%)
Similarity:138/320 - (43%) Gaps:66/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1343 TCNCKNQGEKSCLDNCLNRMVYTECSPSNCPAGEKCRNQKIQRHAVAPGVERFMTADK-GWGVRT 1406
            :|.|   |.....:.|.|...:.|| |..|   ..|.||:.::.... |||.|:|.:. |.|:|.
 Worm    56 SCKC---GTDCTTEECSNFANHREC-PRGC---SNCENQRFRKRQF
C-GVETFLTDNGIGHGLRA 112

  Fly  1407 KLPIAKGTYILEYVGEVVTEKEFKQRMASIYLND--THHYCLHLDGGLVIDGQRMGSDCRFVNHS 1469
            ...||.|..||||.||.:|:.|..:|:.. |..|  .|.|...:.....:|..|.|:..||:|||
 Worm   113 TEEIATGKLILEYRGEAITKAEHNKRVKR-YKKDGIKHSYSFEVGRNYYVDPTRKGNSARFINHS 176

  Fly  1470 CEPNCEMQKWSV--NGLSRMVLFAKRAIEEGEELTYDYNFSLFNPSEGQPCRCNTPQCRGVIG-- 1530
            |.||..::.|:|  ..:..:.:||.:.|:.|||:|:||..|..|   .|||:|....|||.||  
 Worm   177 CNPNALVKVWTVPDRPMKSLGIFASKVIKPGEEITFDYGTSFRN---DQPCQCGEAACRGWIGKP 238

  Fly  1531 ----------------GKSQRVKPLPAVEAKPSGEG----LSG-------RNGRQRK-------- 1560
                            |:..::.|...:....:|.|    |||       |.||:||        
 Worm   239 STSEVPKDVSKELKKRGRKPKMDPTAPISTTSTGGGDKGKLSGTIPVPKSRRGRKRKTDVTAPVP 303

  Fly  1561 --QKAKKHAQRQAGKDISSAVAVAKLQPLSEKEKKLVRQFNTFLVRNFEK----IRRCKA 1614
              .|.|:|:.....:....    ..::|.||::  :....|..|.:.::.    :..|::
 Worm   304 LATKTKRHSPPAENESEDK----ENVKPPSEED--ITNAMNNLLNKTYDNQNGVLDECRS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ash1NP_001246834.1 AWS 1340..1388 CDD:197795 12/44 (27%)
SET 1392..1512 CDD:214614 46/124 (37%)
Bromo_ASH1 1680..1787 CDD:99955
PHD_ASH1L 1858..1900 CDD:277023
BAH_polybromo 1929..2073 CDD:240068
set-12NP_509306.2 AWS 53..94 CDD:197795 12/44 (27%)
SET 97..221 CDD:214614 47/127 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.