DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ash1 and set-23

DIOPT Version :9

Sequence 1:NP_001246834.1 Gene:ash1 / 40133 FlyBaseID:FBgn0005386 Length:2226 Species:Drosophila melanogaster
Sequence 2:NP_741320.1 Gene:set-23 / 176969 WormBaseID:WBGene00021515 Length:244 Species:Caenorhabditis elegans


Alignment Length:247 Identity:81/247 - (32%)
Similarity:113/247 - (45%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1319 NYRKIRTNVYAESVRPNLAGFD----HPTCNCKNQGEK----SCLDNCLNRMVYT---------- 1365
            ||.||.:.:..    |.::..|    ...|||:.:...    |||.|.::.  ||          
 Worm     2 NYEKIDSTIPG----PGISETDWNDVFEGCNCEAECSSAAGCSCLINKIDN--YTVDGKINKSSE 60

  Fly  1366 ---ECSPSNCPA---GEKCRNQKIQRHAVAP--GVERFMTAD--KGWGVRTKLPIAKGTYILEYV 1420
               ||| ..|..   ...|||:.:|   ..|  .:|.|.|.:  ||:|||....||.|.::.||.
 Worm    61 LLIECS-DQCACILLPTSCRNRVVQ---CGPQKKLEIFSTCEMAKGFGVRAGEQIAAGEFVCEYA 121

  Fly  1421 GEVVTEKEFKQRMASIYLNDTHHYCLHLD---GG----LVIDGQRMGSDCRFVNHSCEPNCEMQK 1478
            ||.:.|:|.::|......:|  :|.|.|.   ||    ..:|.:..|:..||:|||||||||:  
 Worm   122 GECIGEQEVERRCREFRGDD--NYTLTLKEFFGGKPVKTFVDPRLRGNIGRFLNHSCEPNCEI-- 182

  Fly  1479 WSVNGLSRMV----LFAKRAIEEGEELTYDYNFSLFNPSEGQPCRCNTPQCR 1526
             .:..|.||:    :||||.|..||||.|||..|.......:.|.|.:.:||
 Worm   183 -ILARLGRMIPAAGIFAKRDIVRGEELCYDYGHSAIEGENRKLCLCKSEKCR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ash1NP_001246834.1 AWS 1340..1388 CDD:197795 18/71 (25%)
SET 1392..1512 CDD:214614 53/132 (40%)
Bromo_ASH1 1680..1787 CDD:99955
PHD_ASH1L 1858..1900 CDD:277023
BAH_polybromo 1929..2073 CDD:240068
set-23NP_741320.1 Pre-SET <6..81 CDD:282838 18/81 (22%)
SET 89..213 CDD:214614 51/128 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.