DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14100 and yfiF

DIOPT Version :10

Sequence 1:NP_649130.2 Gene:CG14100 / 40132 FlyBaseID:FBgn0036889 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_417076.1 Gene:yfiF / 947066 ECOCYCID:EG11786 Length:345 Species:Escherichia coli


Alignment Length:166 Identity:40/166 - (24%)
Similarity:68/166 - (40%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 DNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWES-KALRGGCGGQFRVPIRDDVTWDELALTI 304
            :|...|:|||.::|:||......|||.....  .|| .|:|...||...|   ..:|.|.:.   
E. coli   203 ENESNPHNLGGMMRSCAHFGVKGVVVQDAAL--LESGAAIRTAEGGAEHV---QPITGDNIV--- 259

  Fly   305 PPEAADDC----HVFIAETNQRKRENNQTIDYADIKGLGAHNLLIIGGESHGVSEEAYRFLNL-- 363
              ...||.    :..:..::::.:...:|       .|.|..:|::|.|..|:.:.|....:|  
E. coli   260 --NVLDDFRQAGYTVVTTSSEQGKPLFKT-------SLPAKMVLVLGQEYEGLPDAARDPNDLRV 315

  Fly   364 -VGGKGKCIYIPLAAGIDSLNVASALTLLLFELRRK 398
             :.|.|         .:..||::.|..:||.|..|:
E. coli   316 KIDGTG---------NVAGLNISVATGVLLGEWWRQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14100NP_649130.2 SpoU_sub_bind 141..215 CDD:429793
SpoU-like_RNMTL1 236..395 CDD:349979 38/161 (24%)
yfiFNP_417076.1 PRK10864 1..345 CDD:236779 40/166 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.