DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14100 and TRM3

DIOPT Version :9

Sequence 1:NP_649130.2 Gene:CG14100 / 40132 FlyBaseID:FBgn0036889 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_010171.1 Gene:TRM3 / 851446 SGDID:S000002270 Length:1436 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:37/173 - (21%)
Similarity:68/173 - (39%) Gaps:46/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 ITVVCDNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWESKALRGGCGGQFRVPIRDDVTWDEL 300
            :.||...:.:|.|||.|.|.|..|....:.|..                    :.:::...:..:
Yeast  1286 LIVVSSLVDKPPNLGGICRLCDVLGVGLLTVQD--------------------IKVKNHPQFKNV 1330

  Fly   301 ALT----IPPE--AADDCHVFIAETNQRKRENNQTI--DYADIKGLGAHN--------LLIIGGE 349
            |:|    :|.|  |.|:...|:.|   :|:|....|  :..| |.:...|        |:::|.|
Yeast  1331 AVTADRWMPMEEVALDEIASFMKE---KKKEGYTLIGLEQTD-KSVKLDNNFQFPKKSLILLGTE 1391

  Fly   350 SHGVSEEAYRFLNLVGGKGKCIYIPLAAGIDSLNVASALTLLL 392
            :.|:.......|:|      |:.|.....|.|:|:.:|..:::
Yeast  1392 AFGIPGTLLSELDL------CLEIQQFGVIRSMNIQTATAVIV 1428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14100NP_649130.2 SpoU 131..399 CDD:223640 37/173 (21%)
SpoU_sub_bind 141..214 CDD:285300
SpoU_methylase 235..393 CDD:278985 37/173 (21%)
TRM3NP_010171.1 SpoU-like_TRM3-like 1286..1431 CDD:349964 37/173 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.