DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14100 and AT4G15520

DIOPT Version :9

Sequence 1:NP_649130.2 Gene:CG14100 / 40132 FlyBaseID:FBgn0036889 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_193287.1 Gene:AT4G15520 / 827225 AraportID:AT4G15520 Length:222 Species:Arabidopsis thaliana


Alignment Length:181 Identity:40/181 - (22%)
Similarity:65/181 - (35%) Gaps:63/181 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 FPITVVCDNIREPNNLGSIIRTCAALPCSQVVV----------THGCCDPWESKALRGGCGGQFR 288
            |...||..||.:.:|:|::.|:..|...:::::          :||     .:..:|      ||
plant     4 FESYVVVHNIAKRHNVGTLARSATAFGVTELILVGRRDFNAFGSHG-----SASHIR------FR 57

  Fly   289 VPIRDDVTWDELALTIPPEAADDCHVFIAETNQRKRENNQTI---DYADIKGLGAHN-------- 342
                                  ..|..|...|..|.|.:..|   :.||  |..|.|        
plant    58 ----------------------HFHSLIEARNYLKEEKDCDICGVEIAD--GASAVNEHPFKRNT 98

  Fly   343 LLIIGGESHGVSEEAYRFLNLVGGKGKCIYIP-LAAGIDSLNVASALTLLL 392
            ..::|.|..|:|.:.|...:..      :||| ...|..||||..|.:::|
plant    99 AFLLGNEGSGLSAKEYEICDFF------VYIPQYGCGTASLNVTVAASIVL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14100NP_649130.2 SpoU 131..399 CDD:223640 40/181 (22%)
SpoU_sub_bind 141..214 CDD:285300
SpoU_methylase 235..393 CDD:278985 39/180 (22%)
AT4G15520NP_193287.1 SpoU-like 6..146 CDD:349969 39/179 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.