DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14100 and si:dkey-85a20.4

DIOPT Version :9

Sequence 1:NP_649130.2 Gene:CG14100 / 40132 FlyBaseID:FBgn0036889 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_001921874.4 Gene:si:dkey-85a20.4 / 566303 ZFINID:ZDB-GENE-090313-347 Length:1579 Species:Danio rerio


Alignment Length:187 Identity:48/187 - (25%)
Similarity:75/187 - (40%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 EKNLAEQQ---RLGSQPFPITVVCDNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWESKALRG 281
            |..|..||   |||.....:.||...|.:|.|||.:.|||.......:|:          .:||.
Zfish  1406 EPELMAQQRALRLGKLTSSLLVVASLIDKPTNLGGLCRTCEIFGAKALVL----------DSLRH 1460

  Fly   282 GCGGQFRVPIRDDVTWDELALTIPPEAADDCHVFIAE----TNQRKRENNQTI-DYADIKGLGAH 341
            ....||:........|..:....|.|.:|...:..:|    ....:..|:|:: ||.    ....
Zfish  1461 VNDKQFQALSVSSELWLPMMEVKPAELSDFLQLKKSEGYWVIGVEQTSNSQSLQDYT----FPEK 1521

  Fly   342 NLLIIGGESHGVSEEAYRFLNLVGGKGKCIYIPLAAGIDSLNVASALTLLLFELRRK 398
            :||::|.|..|:.....:.|::      |:.||......||||..:..||::|..|:
Zfish  1522 SLLLLGNEREGIPANVLQLLDV------CVEIPQFGVTRSLNVHVSAALLVWEYTRQ 1572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14100NP_649130.2 SpoU 131..399 CDD:223640 48/187 (26%)
SpoU_sub_bind 141..214 CDD:285300
SpoU_methylase 235..393 CDD:278985 39/162 (24%)
si:dkey-85a20.4XP_001921874.4 SpoU_methylase 1424..1567 CDD:306957 39/162 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.