DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14100 and MRM3

DIOPT Version :9

Sequence 1:NP_649130.2 Gene:CG14100 / 40132 FlyBaseID:FBgn0036889 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_060616.1 Gene:MRM3 / 55178 HGNCID:18485 Length:420 Species:Homo sapiens


Alignment Length:416 Identity:129/416 - (31%)
Similarity:213/416 - (51%) Gaps:58/416 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PRGEIQDALDIEANLFGNSDLRHEPMN----TREALRKNRFAGRKP-KVPF-ASVASRNLSAPSN 89
            |..::..|.|::|..:..: ||..|:.    :.|.:.:.|..|::| |.|. ||...:....|..
Human    14 PLLQVVQAWDLDARRWVRA-LRRSPVKVVFPSGEVVEQKRAPGKQPRKAPSEASAQEQREKQPLE 77

  Fly    90 PAPRVAPTPAPVIKDNELNLEFVRLTLQDPLTSTLLTTVRSRKRRDKNRQIIVEGRRLIQEALQC 154
            .:...||:..     .|..|.:.:....|...|:::|.|:||..|:|..:|::||||||.:||:.
Human    78 ESASRAPSTW-----EESGLRYDKAYPGDRRLSSVMTIVKSRPFREKQGKILLEGRRLISDALKA 137

  Fly   155 GLKMEVLLFSQKDQLALVKEEVGVAQVETGTKIYKVPQHDLKTWSSLVTPPGLMAIFDRPSDKGL 219
            |...::..||:.:.|    :|:.|.::: |..:.||...|:|.||.||||.|:|.||.:|....:
Human   138 GAVPKMFFFSRLEYL----KELPVDKLK-GVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKM 197

  Fly   220 EKNLAEQQRLGSQPFPITVVCDNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWESKALRGGCG 284
            .....:.|    ...|:.::|||:|:|.|||:|:|:.|...||:|::|.||.|.||.|.||.|.|
Human   198 TYPKTQLQ----HSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMG 258

  Fly   285 GQFRVPIRDDVTWDELALTIPPE----AADDCHVFI-AETNQRKRENNQTIDYADIK-------- 336
            ..||:||.:::.|:.:...:||:    .||:|.::. ||.:.:..::....|...:|        
Human   259 AHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSNKASDHGWVCDQRVMKFHKYEEEE 323

  Fly   337 --GLGAHN--------------------LLIIGGESHGVSEEAYRFLNLVGGKGKCIYIPLAAGI 379
              ..||..                    .::||||::|||.|:.:.....|||.  :.||:..|:
Human   324 DVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETYGVSLESLQLAESTGGKR--LLIPVVPGV 386

  Fly   380 DSLNVASALTLLLFELRRKLIHQASE 405
            ||||.|.|.::||||.:|:|..:|.:
Human   387 DSLNSAMAASILLFEGKRQLRGRAED 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14100NP_649130.2 SpoU 131..399 CDD:223640 102/302 (34%)
SpoU_sub_bind 141..214 CDD:285300 29/72 (40%)
SpoU_methylase 235..393 CDD:278985 63/192 (33%)
MRM3NP_060616.1 SpoU_sub_bind 125..191 CDD:214943 29/70 (41%)
SpoU-like_RNMTL1 210..402 CDD:349979 64/193 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6526
eggNOG 1 0.900 - - E1_COG0566
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10033
Inparanoid 1 1.050 180 1.000 Inparanoid score I4010
Isobase 1 0.950 - 0 Normalized mean entropy S7460
OMA 1 1.010 - - QHG50134
OrthoDB 1 1.010 - - D1183644at2759
OrthoFinder 1 1.000 - - FOG0006042
OrthoInspector 1 1.000 - - oto89033
orthoMCL 1 0.900 - - OOG6_102998
Panther 1 1.100 - - LDO PTHR43191
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4335
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.