DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14100 and CG18596

DIOPT Version :9

Sequence 1:NP_649130.2 Gene:CG14100 / 40132 FlyBaseID:FBgn0036889 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651031.1 Gene:CG18596 / 42622 FlyBaseID:FBgn0038953 Length:1136 Species:Drosophila melanogaster


Alignment Length:330 Identity:60/330 - (18%)
Similarity:110/330 - (33%) Gaps:105/330 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VRLTLQDPLTSTLLTTVRSRKRRDKNRQIIVEGRRLIQE-ALQC--------------------- 154
            :::.:.|.|..::..|:     .:|..:...|.|.|:.| ..||                     
  Fly   858 IQMPIADALKKSIKVTL-----SEKLTEFQCEARLLLPELGKQCPTSVSDCILMMTNAPFDENIS 917

  Fly   155 ----------GLKMEVLLFSQKDQLALVKEEVGVAQVETGTKIYKVPQHDLKTWSSLVTPPGLMA 209
                      .||..:..|.:|..:.:.:....:|.:....:....|..|:...|..|.      
  Fly   918 FISCSYDFRMKLKRALETFKRKQSVLIPELATSLAALNGNVQRKMNPVGDIYPESDFVV------ 976

  Fly   210 IFDRPSDKGLEKNLAEQQRLGSQPFPITVVCDNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPW 274
                 |:|..:.:            .:.||...|.:..|||.:.|||..|..:.:::        
  Fly   977 -----SNKARDDH------------ELIVVASLIDKLPNLGGLARTCEVLGVNTLIL-------- 1016

  Fly   275 ESKALRGGCGGQFRVPIRDDVTWDELALT---------IPPEAADDCHVFIAETNQR------KR 324
                   |...|..   :.|.|  .|::|         :.||:...   |:.|....      ..
  Fly  1017 -------GLKSQAE---KSDFT--NLSMTAEKTLNILEVNPESLAG---FLLEKQMEGYKIVGAE 1066

  Fly   325 ENNQTIDYADIKGLGAHNLLIIGGESHGVSEEAYRFLNLVGGKGKCIYIPLAAGIDSLNVASALT 389
            :...:.::.|.| ....::|::|.|.||:.      .||:|.....:.||....:.||||..|.:
  Fly  1067 QTAHSTNFVDFK-FPKKSILLLGHEKHGIP------ANLIGFLDYAVEIPQYGLVRSLNVHVAGS 1124

  Fly   390 LLLFE 394
            |.::|
  Fly  1125 LFIWE 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14100NP_649130.2 SpoU 131..399 CDD:223640 57/311 (18%)
SpoU_sub_bind 141..214 CDD:285300 15/104 (14%)
SpoU_methylase 235..393 CDD:278985 38/172 (22%)
CG18596NP_651031.1 SpoU_methylase 986..1128 CDD:278985 38/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0566
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.