DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shal and KCO1

DIOPT Version :10

Sequence 1:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:123 Identity:31/123 - (25%)
Similarity:63/123 - (51%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 LVFSLAMAIIIFATVMFYAEKN-VNGTNFTSIPAAFWYTIVTMTTLGYGDMVPETIAGKIVGGVC 390
            ::..||:.:.| .|:.||..:: ::|...:.:..|.::.||||||:||||:||.:.|.:::....
plant    79 VIMFLALYLTI-GTLCFYLVRDQISGHKTSGVVDALYFCIVTMTTVGYGDLVPNSSASRLLACAF 142

  Fly   391 SLSGVLVIALPVPVIVSNFSRIYHQNQRADKRKAQRKARLARIRIAKASSGAAFVSKK 448
            ..||::::.             :..::.||....:::|.|.|....:.|.|...:.|:
plant   143 VFSGMVLVG-------------HLLSRAADYLVEKQEALLVRAFHLRQSFGPTDILKE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727
Ion_trans 188..415 CDD:459842 23/88 (26%)
DUF3399 471..535 CDD:463381
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:462301 25/95 (26%)
Ion_trans_2 202..277 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.