DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shal and kcnq5b

DIOPT Version :9

Sequence 1:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster
Sequence 2:XP_697081.4 Gene:kcnq5b / 568646 ZFINID:ZDB-GENE-090312-178 Length:974 Species:Danio rerio


Alignment Length:313 Identity:73/313 - (23%)
Similarity:145/313 - (46%) Gaps:51/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 RDRKRENAE-RLMDDKL---SENGDQNLQQLTNMRQKMWRAFENPHTSTSALVFYYVTGFFIAV- 197
            |||.::.|. .|:...|   :::|.:| .:...::..::...|.|.    :..|.|....|:.| 
Zfish    64 RDRGKQGARLSLLGKPLVYGTQSGRRN-ARYRRIQNYLYNVLERPR----SWAFIYHAFVFVLVF 123

  Fly   198 -SVMANVVETVPCGHRPGRAGTLPCGERYKIVFFCLDTACVMIFTAEYLLRLFAA---------P 252
             .::.:|..|:| .|:...:.:|          ..|:...:::|..||::|:::|         .
Zfish   124 GCLVLSVFSTIP-DHQEMASQSL----------LILEFVMIVVFGLEYIIRIWSAGCCCRYRGWQ 177

  Fly   253 DRCKFVRSVMSIIDVVAIMP--YYIGLGITDNDDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGY 315
            .|.:|.|....:||::.::.  ..:..|...|...:.|..:||..::.|:.:..|.....::||.
Zfish   178 GRLRFARKPFCVIDIIVLIASVAVVSAGSQSNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGS 242

  Fly   316 TLKSCASEL------GFLVFSLAMAIIIFATVMFY-AEKNVNGTNFTSIPAAFWYTIVTMTTLGY 373
            .:.:.:.||      ||||       :||::.:.| .||..| .:|.:...|.|:..:|:||:||
Zfish   243 VVYAHSKELVTAWYIGFLV-------LIFSSFLVYLVEKEFN-KDFATYADALWWGTITLTTIGY 299

  Fly   374 GDMVPETIAGKIVGGVCSLSGVLVIALPVPVIVSNFS---RIYHQNQRADKRK 423
            ||..|:|..|:::....:|.|:....||..::.|.|:   :..|:.:..:||:
Zfish   300 GDKTPKTWTGRMLSAGFALLGISFFTLPAGILGSGFALKVQEQHRQKHFEKRR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727 3/5 (60%)
Ion_trans 188..415 CDD:395416 59/249 (24%)
DUF3399 445..540 CDD:403174
kcnq5bXP_697081.4 Ion_trans 145..343 CDD:278921 52/215 (24%)
Ion_trans_2 259..333 CDD:285168 26/81 (32%)
KCNQ_channel 443..625 CDD:281513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.