DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Shal and RpL37a

DIOPT Version :9

Sequence 1:	NP_001097646.1	Gene:	Shal / 40129	FlyBaseID:	FBgn0005564	Length:	571	Species:	Drosophila melanogaster
Sequence 2:	NP_001259561.1	Gene:	RpL37a / 32446	FlyBaseID:	FBgn0030616	Length:	93	Species:	Drosophila melanogaster

Alignment Length:	49	Identity:	10/49 - (20%)
Similarity:	21/49 - (42%)	Gaps:	5/49 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   411 RIYHQNQRADKRKAQRKARLARIRIAKASSGAAF-----VSKKKAAEAR 454
            |.|:.:.:|.:||.....|:..:::.:......|     ...|||..::
  Fly    45 RSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK 93

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Shal	NP_001097646.1	BTB_POZ_Shal-like	6..144	CDD:349727
		Ion_trans	188..415	CDD:395416	2/3 (67%)
		DUF3399	445..540	CDD:403174	3/10 (30%)
RpL37a	NP_001259561.1	PTZ00073	1..91	CDD:240257	10/45 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2126
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900