DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shal and kvs-3

DIOPT Version :9

Sequence 1:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_505407.2 Gene:kvs-3 / 185719 WormBaseID:WBGene00018402 Length:451 Species:Caenorhabditis elegans


Alignment Length:428 Identity:127/428 - (29%)
Similarity:218/428 - (50%) Gaps:64/428 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VPIATHPLPPPPMPKDRRKTDDEKLLINVSG-----------RRFETWR-------NTLEKYPDT 65
            ||:...|: ..|:|........:.:.:||.|           ||..|.|       :.:|:..|.
 Worm     5 VPLIESPV-AGPVPNGSVVRPPDIVFVNVGGRRARLNSDIIIRRLATSRLAVFCEKSHVERLTDC 68

  Fly    66 LLGSNEREFFYDEDCKEYFFDRDPDIFRHILNYYRTGKLHYPKHECLTSYDEELAFFGIMPDVIG 130
                   :.|: |...||:|:|.|.||.:::::|.|||||.|...|......||.::.|....:.
 Worm    69 -------DAFF-ESTSEYYFERSPIIFEYVIDFYVTGKLHRPMDICPIRLRYELDYWRIPTPFMS 125

  Fly   131 DCCYEDYRDR---KRENAERLMDDKLSEN-------GDQNLQQLTNMRQKMWRAFENPHTSTSAL 185
            .||..:..:.   |....:..:|..|..:       |.|.|        |::|..|||.:|:.|.
 Worm   126 PCCILEENNNIAGKMSTEKAFVDSSLPSSCFDKVVLGPQRL--------KLYRLMENPRSSSGAK 182

  Fly   186 VFYYVTGFFIAVSVMANVVETVPCGHRPGRAGTLPCGERYKIVFFCLDTACVMIFTAEYLLRLFA 250
            :|...:..|:.:|::..::.::|......:       |.:.::.: |:..|::.||.|||.||..
 Worm   183 IFSVGSALFVLLSLLGLILSSMPELQDENK-------EPHYLLHW-LELLCMVYFTFEYLARLLV 239

  Fly   251 APDRCKFVRSVMSIIDVVAIMPYYIGLGITDND-----DVSGAFVTLRVF---RVFRIFKFSRHS 307
            .|.:.:|:||.:::||::.::|:.|.   ..|:     :..||.:.:||.   ||.||||.:|:|
 Worm   240 NPKKAEFIRSPLNVIDLLTVLPFMIE---AFNELQWMKEFRGAMLVVRVMRLARVARIFKLARYS 301

  Fly   308 QGLRILGYTLKSCASELGFLVFSLAMAIIIFATVMFYAEKNVNGTNFTSIPAAFWYTIVTMTTLG 372
            .|||..|.|:|..|:||..|...|...|::|:|.:::.|::...:.|.|||||.|:.::||||:|
 Worm   302 TGLRAFGETMKKSAAELSMLGMFLVTGIMLFSTAIYFFERDEPNSKFYSIPAACWWCVITMTTVG 366

  Fly   373 YGDMVPETIAGKIVGGVCSLSGVLVIALPVPVIVSNFS 410
            |||:||.|..||:|..:.|:.|::|:|.|:.:|:..|:
 Worm   367 YGDLVPITAGGKVVAALASVCGIIVLAFPISMIIDKFA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727 37/145 (26%)
Ion_trans 188..415 CDD:395416 77/231 (33%)
DUF3399 445..540 CDD:403174
kvs-3NP_505407.2 BTB 26..133 CDD:197585 31/114 (27%)
BTB_2 28..127 CDD:280393 29/106 (27%)
Ion_trans 206..407 CDD:278921 74/210 (35%)
Ion_trans_2 324..405 CDD:285168 33/81 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.