DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shal and Kcnq1

DIOPT Version :9

Sequence 1:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster
Sequence 2:XP_006508551.2 Gene:Kcnq1 / 16535 MGIID:108083 Length:688 Species:Mus musculus


Alignment Length:318 Identity:81/318 - (25%)
Similarity:136/318 - (42%) Gaps:69/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 TNMRQKMWRAFENPHTSTSALVFYYVT-------------------GFFIA-VSVMANVVETVPC 209
            |:::.:::...|.| |.....|:::..                   ||.|. |.::.:|:.|:  
Mouse   103 THIQGRVYNFLERP-TGWKCFVYHFTVPGTMHQLPTSILIPKNMPGGFLIVLVCLIFSVLSTI-- 164

  Fly   210 GHRPGRAGTLPCGERYKIV----FFCLDTACVMIFTAEYLLRLFAAPDRCKFV---------RSV 261
                         |:|..:    .|.::...|:.|..||::||::|..|.|:|         |..
Mouse   165 -------------EQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKP 216

  Fly   262 MSIIDVVAIMPYYIGLGITDNDDV--SGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASEL 324
            :||||::.::...:.|.:.....|  :.|...:|..::.|:....|.....|:||..:.....||
Mouse   217 ISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQEL 281

  Fly   325 ------GFLVFSLAMAIIIFATVMFY-AEK---NVNG-TNFTSIPAAFWYTIVTMTTLGYGDMVP 378
                  |||.       :||::...| |||   |.:| ..|.|...|.|:.:||:||:||||.||
Mouse   282 ITTLYIGFLG-------LIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVP 339

  Fly   379 ETIAGKIVGGVCSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRKAQRKARLARIRIA 436
            :|..||.:....|:..:...|||..::.|.|:....|.||......|..|..:.|:.|
Mouse   340 QTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727
Ion_trans 188..415 CDD:395416 69/272 (25%)
DUF3399 445..540 CDD:403174
Kcnq1XP_006508551.2 Ion_trans 149..378 CDD:366146 69/250 (28%)
KCNQ_channel <530..636 CDD:367540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.