DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and CG34462

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:108 Identity:30/108 - (27%)
Similarity:56/108 - (51%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1115 ALSSHAPVAATAYLKSAPVTQHAVLKVVPEKH---LEHFDAHP-----RYAFEYAVNDPHTGDNK 1171
            |||:  |:::...:.:.|       :|.|||.   :.::..|.     .|:|.|.:|||.|.:::
  Fly    22 ALSN--PLSSKIEVYNQP-------EVTPEKERAKVRNYFVHEPYGPNTYSFGYEINDPQTQNSQ 77

  Fly  1172 HQKEER--DGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212
            .::|:|  :|. ::|.|....|||.:...||.|..:.|:.|::
  Fly    78 FREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 18/53 (34%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.