DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and LOC5667562

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:XP_001688322.1 Gene:LOC5667562 / 5667562 VectorBaseID:AGAMI1_001759 Length:162 Species:Anopheles gambiae


Alignment Length:117 Identity:50/117 - (42%)
Similarity:62/117 - (52%) Gaps:20/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1096 VGGIGPLGAGFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEY 1160
            :|...||||             .|||:.  ||...|.|....|.||.     :.:|.:|:|::.|
Mosquito    20 IGYPAPLGA-------------YHAPLG--AYPAVAKVAAPVVAKVA-----DDYDPNPQYSYSY 64

  Fly  1161 AVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212
            .:.|..|||||.|:|.|.||||.|.||||||||..|.|:|.||...||:|.|
Mosquito    65 HIADALTGDNKEQQESRSGDVVTGSYSLVEPDGTRRVVEYTADPVNGFNAVV 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 29/51 (57%)
LOC5667562XP_001688322.1 Chitin_bind_4 60..112 CDD:459790 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.