DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr92F

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:448 Identity:102/448 - (22%)
Similarity:153/448 - (34%) Gaps:140/448 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 YLPAAPAVAKVATGYGISGSGAVSHQYVSKP------ALTLAAPAVAKVATYAAPAIS----SYS 855
            ::.||..::.|:.    |..||||.||....      :...|.|...|..|.:....:    ||.
  Fly     5 FIAAALLISTVSA----SWHGAVSTQYQHLDPHSHTYSYGYADPNSQKHETRSHDGTTHGSYSYV 65

  Fly   856 TGAGISKGLSY----------------------AAPVVSTGHGYGGSASEYSSGAVSHQYVSKPA 898
            .|.|..:.:||                      ||||.:..|.:|..| .|:.|.:....::...
  Fly    66 DGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGAYA-PYAHGPIHIPVLTHGG 129

  Fly   899 VAISAAPAI--AKVATYVA-PAVGHILGGHAVGSVPVLSTKLATGYGGSGSGYSSGAVSHQYVSK 960
            |.:. .|.:  ||.|...| .|..|..|||.:....:        |||   |::.|..:|..::.
  Fly   130 VPVD-TPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSI--------YGG---GWAYGQAAHVPLTH 182

  Fly   961 PAVAISAAPAIAKVAVPTVSHISTGPSTPLGVGVGYGSSGHGGVLLGAPLTKLTSAPAYALGGKL 1025
            ..|.:......|..|....:|..         .:|:.:..|     |||:.  |....:|   |.
  Fly   183 GGVPVDTPDVQAAKAEHYAAHAK---------ALGHVAHAH-----GAPVE--TPEVQHA---KA 228

  Fly  1026 ASSTAYGIQAGNLGHGSGP--SGGYYGAI----------SLGHAKVS--PALSY---HGLLSHGS 1073
            |...|:.  |...||...|  .|||:..:          .:.|||.:  .|||.   ||..||||
  Fly   229 AHFAAHA--AARSGHAVSPINHGGYHVPVIHNGVPVDTPEVQHAKAAHYAALSQASAHGGASHGS 291

  Fly  1074 ---GLASGASSLAHLDSSLSGYSHGVGGIGPLGAGFYRYAPSVPALSSHAPV-------AATAYL 1128
               |...|....:|  ||.:.|:.|....||:         .:|.:.:..||       |..|:|
  Fly   292 WDDGSYDGRWEQSH--SSHNSYASGYAHKGPI---------HIPVIHNGVPVEPAEVQHARAAHL 345

  Fly  1129 KSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEY 1186
            .:.....|.    .|..|..::                 |.|.|:.:        |:|
  Fly   346 NALAAAGHG----APASHGSYY-----------------GGNGHEDD--------GQY 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 5/31 (16%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.