DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr92A

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:137 Identity:25/137 - (18%)
Similarity:54/137 - (39%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LEALTESKVAVV--MTSDEEVSSVGFLEELI-----------VIIEFQEKRSLTVIPVFLTKHPL 111
            ::||..|.::.:  ||:|:..:.:...||:|           ..::.......|.|.||..::. 
  Fly     1 MDALENSLISKMSQMTTDDRENLIHKFEEIISPQMIPHDLAAFYLDLANWNLSTAISVFYDQNG- 64

  Fly   112 DVEKVSQIFPERAKIWRTAIAKLDN---IAAQYSFSRNLAVMHGTHRIK----QIADDIRLMFLS 169
            |:..:.:.|  |.....:.:.:..|   |:..:::..|.....|...:.    :..|..||.|:.
  Fly    65 DLLHMEEAF--RQTCLSSTVKECTNREAISGSFTYRPNSTFFCGWRVVNDGRFRWPDGTRLAFVD 127

  Fly   170 SASSDFK 176
            ....|::
  Fly   128 GDPIDYE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344 9/54 (17%)
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 6/53 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.