DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Ccp84Af

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:120 Identity:54/120 - (45%)
Similarity:67/120 - (55%) Gaps:16/120 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1107 YRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNK 1171
            |..||:| |..:.||||..          ||  :.|..|..|.:|.||:|.|.|.|.|..:||:|
  Fly    26 YHAAPAV-ATYAQAPVAVA----------HA--QPVLTKATEEYDPHPQYKFAYDVQDSLSGDSK 77

  Fly  1172 HQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEVIN--SRDQGKIVAK 1224
            .|.||||||||.|||||::.||..|.|:|.:|...||:| |:|  ..|..|.|.|
  Fly    78 SQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNA-VVNRVPLDHVKTVVK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 28/51 (55%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 28/51 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.