powered by:
Protein Alignment Cpr76Bd and Edg84A
DIOPT Version :9
Sequence 1: | NP_001262052.1 |
Gene: | Cpr76Bd / 40123 |
FlyBaseID: | FBgn0036881 |
Length: | 1231 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524247.1 |
Gene: | Edg84A / 40818 |
FlyBaseID: | FBgn0000552 |
Length: | 188 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 36/63 - (57%) |
Similarity: | 44/63 - (69%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1150 FDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212
:|:||:|:|.|.|.||.|||.|.|.|.||||||.|:||:.:.||..|||.|.||...||:|.|
Fly 31 YDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVV 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45453131 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.