DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr76Ba

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:160 Identity:57/160 - (35%)
Similarity:70/160 - (43%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1074 GLASGASSLAHLDSSLSGYS--HGVGGIGPLGAGFYRYAP--------------SVPALSSHAPV 1122
            |:|: ||.:.|     .|||  ||||    .....:..||              .||...|...|
  Fly    14 GVAA-ASYIPH-----GGYSHEHGVG----YSIQTHHEAPKQWQDHHQAHHQWVDVPKAHSWGTV 68

  Fly  1123 AATAYLKSAPVTQHAVLKVVPEKHLE--HFDA---HPRYAFEYAVNDPHTGDNKHQKEERDGDVV 1182
            ....:.:.|||..|       :.|.:  |.:.   ||:|.|.|.|.|..|||.|.|.|.||||.|
  Fly    69 QDHHHQQWAPVAAH-------DSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKV 126

  Fly  1183 KGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212
            ||.|::.|.||..|.|:|.||...||.|.|
  Fly   127 KGGYTMKEADGRTRIVEYTADSHNGFQATV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 27/51 (53%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.