DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr72Eb

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:61 Identity:24/61 - (39%)
Similarity:35/61 - (57%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1149 HFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFH 1209
            |.|.|.:||:.|..  |..  :||:....|| |::|.:|.::.:|..:||.|.||.| |||
  Fly    38 HQDEHGQYAYGYMA--PLY--SKHETRTVDG-VIRGTFSHIDANGETQTVDYVADAE-GFH 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 18/51 (35%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:459790 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.