DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and CG13670

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:121 Identity:47/121 - (38%)
Similarity:60/121 - (49%) Gaps:17/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1095 GVGGIGPLGAGFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFE 1159
            |.|.||...|..|.||      ....||....:|    ||.|       :.....:.|.|.|:|.
  Fly    59 GCGMIGACAAVGYSYA------RFEGPVVGPEHL----VTVH-------DGRTVDYVARPEYSFA 106

  Fly  1160 YAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEVINS 1215
            |.|.|..|...:::||.|:||.|:|.||:|:|||.:|.|||.||...||.||||.:
  Fly   107 YGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAEVITN 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 25/51 (49%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:459790 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.