DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and CG11350

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster


Alignment Length:600 Identity:194/600 - (32%)
Similarity:253/600 - (42%) Gaps:195/600 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 LSTSYGASGSGAVSH----QYVSKPAVAIAAPAVAKVATYAAPAISSYSTGPAISKVASYAAPTV 434
            |..::.|:.:..|||    ||:.....|.:||    ||:|:||: .|||. .|.:.||||:||..
  Fly     5 LFCAFIAAVAADVSHLPSSQYLPPGRGAASAP----VASYSAPS-QSYSV-EASAPVASYSAPVE 63

  Fly   435 STYSSGYGYGSSGSGAVSHQYVSKPAVAISAAPAIAKVATYAAPAISTYAAAPVVTKVATGYGGS 499
            |:||                      ||.| |||:    :|||||:| |||.      |..|...
  Fly    64 SSYS----------------------VAAS-APAV----SYAAPAVS-YAAP------AQSYSAP 94

  Fly   500 GSGYSSGAVSHQYVSKPAVAKVATYAAPAISTYSAAPAVTKIATSYGGSGHGAVSHQYVSKPAVA 564
            .:.|::.|      |.|||    :||||| .:|| |||.|..|.:              |.|||:
  Fly    95 AATYTAAA------SAPAV----SYAAPA-QSYS-APAATYTAAA--------------SAPAVS 133

  Fly   565 ISAAPAIAKVATYASPAISTY---ATAPVVSKVATYAAPSIATYSSAPALAKVSYSQAADVSHQY 626
            . ||||    .:|::|| :||   |:||.|    |||||: .||::|.:...||||..|:     
  Fly   134 Y-AAPA----QSYSAPA-ATYTAAASAPAV----TYAAPA-QTYTAAASAPAVSYSAPAE----- 182

  Fly   627 ISKPIVAAYPAAAPAVA-TYSSAPAI---TKLSTSYESSGSGAVSHQYV---SKPAVAKVAAYAA 684
                   :|..||...| |:|:....   |...........|..|:.|:   ...|.|..:.|..
  Fly   183 -------SYETAASEPAHTFSANDGYRYKTHKRVVLRRHRRGVPSNDYLPPFQGAASAPTSEYLP 240

  Fly   685 PAISTYATAPAVSTYSSAPVVAKVATGYGGSGSGYSSGAVSHQYISKPAVAIASAPAIAKVATYA 749
            ||.|  |.||...:.:|||.|:     |......||:.|||:   ::||.:..:|.        :
  Fly   241 PAAS--APAPVYQSAASAPAVS-----YAAPAQTYSAPAVSY---AEPAESYETAA--------S 287

  Fly   750 APAISAYSSAPSLTKIATGYGESAHGGAL------------SHQYISKPAIAVAPVAPVLSKTYL 802
            |||.|..|:        .||....|...:            |:.|:  |..|.|| |||.|    
  Fly   288 APAHSFSSN--------DGYRYKTHKRVVLRRHRRDVSHLPSNDYL--PPAASAP-APVYS---- 337

  Fly   803 PAAPAVAKVATGYGISGSGAVSHQYVSKPALTLAAPAVAKVATYAAPAISSYS------TGAGIS 861
              |||                  |..|.||.|..|.|.|...:||||| .|||      |.|..:
  Fly   338 --APA------------------QSYSAPAATYTAAASAPAVSYAAPA-QSYSAPAATYTAAASA 381

  Fly   862 KGLSYAAPVVSTGHGYGGSASEYSSGAVSHQYVSKPAVAISAAPAIAKVATYVAPAVGHILGGHA 926
            ..:||:||..|.      ||.||.|||     .|.|||:.| |||    |:|.|||..:    ..
  Fly   382 PAVSYSAPSQSY------SAPEYYSGA-----ASAPAVSYS-APA----ASYSAPAESY----ET 426

  Fly   927 VGSVPVLSTKLATGY 941
            ..|.|..|.....||
  Fly   427 AASEPAHSFSSNDGY 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791
CG11350NP_647910.1 GYR 198..215 CDD:128953 1/16 (6%)
GYR 296..313 CDD:128953 3/24 (13%)
GYR 438..455 CDD:128953 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.