DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:131 Identity:54/131 - (41%)
Similarity:67/131 - (51%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 IGPLG---AGFYRYAP---SVPALSSHAP--VAATAYLKSAPVTQH---------AVLKVVPEKH 1146
            |.|.|   .|....||   :.||:|..||  :||.|...:||...:         ||.||..   
  Fly    21 IDPYGLSAPGLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAAPVAVAKVAV--- 82

  Fly  1147 LEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAE 1211
            .|.:|.:|:|:|.|.|.|.||||:|.|:|.....||.|.|||.||||.:|.|.|.||...||:|.
  Fly    83 AEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAV 147

  Fly  1212 V 1212
            |
  Fly   148 V 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 27/51 (53%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 27/51 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.