DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:62 Identity:38/62 - (61%)
Similarity:46/62 - (74%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1151 DAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212
            |.||:|||.|.|.|..|||:|.|:|.||||||||.||:|:.||::|||.|.||...||:|.|
  Fly    37 DPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 31/51 (61%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 31/51 (61%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.