DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr62Bb

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster


Alignment Length:73 Identity:44/73 - (60%)
Similarity:52/73 - (71%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1143 PEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETG 1207
            |...|:::| ||:|||.|.|.|..|||.|.|.|.||||||||:||||||||::|||.|.||...|
  Fly    23 PGYALDYYD-HPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHG 86

  Fly  1208 FHAEVINS 1215
            |:|.|..|
  Fly    87 FNAVVTKS 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 34/51 (67%)
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 34/51 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.