| Sequence 1: | NP_001262052.1 | Gene: | Cpr76Bd / 40123 | FlyBaseID: | FBgn0036881 | Length: | 1231 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_647667.1 | Gene: | Cpr62Bb / 38240 | FlyBaseID: | FBgn0035280 | Length: | 194 | Species: | Drosophila melanogaster |
| Alignment Length: | 73 | Identity: | 44/73 - (60%) |
|---|---|---|---|
| Similarity: | 52/73 - (71%) | Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1143 PEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETG 1207
Fly 1208 FHAEVINS 1215 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpr76Bd | NP_001262052.1 | 2A1904 | 130..>270 | CDD:273344 | |
| PRK07003 | <456..>610 | CDD:235906 | |||
| Chitin_bind_4 | 1156..1208 | CDD:459790 | 34/51 (67%) | ||
| Cpr62Bb | NP_647667.1 | Chitin_bind_4 | 35..87 | CDD:459790 | 34/51 (67%) |
| Blue background indicates that the domain is not in the aligned region. | |||||