DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and resilin

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:558 Identity:132/558 - (23%)
Similarity:177/558 - (31%) Gaps:204/558 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 VAAYAAPAISTYATAPAVSTYSSAPVVAKVATG----------YGGSGSGYSSGAVSHQYISKPA 733
            |.:|..|: .:|. ||..|.....|..:..|.|          ||..|.|...|.....|..||:
  Fly    23 VNSYLPPS-DSYG-APGQSGPGGRPSDSYGAPGGGNGGRPSDSYGAPGQGQGQGQGQGGYAGKPS 85

  Fly   734 VAIASAPAIAKVATYAAPAISAYSSAPSLTKIATGYGESAHGGALSHQYISKPAIAVAPVAPVLS 798
                        .||.||.                 |.:.:||..|..|                
  Fly    86 ------------DTYGAPG-----------------GGNGNGGRPSSSY---------------- 105

  Fly   799 KTYLPAAPAVAKVATGYGISGSGAVSHQYVSKPALTLAAPAVAKVA----TYAAPAISSYSTGAG 859
                 .||.          .|:|       .:|:.|..||......    ||.||.      |.|
  Fly   106 -----GAPG----------GGNG-------GRPSDTYGAPGGGNGGRPSDTYGAPG------GGG 142

  Fly   860 ISKG----LSYAAPVVSTGHGYGGSASEYSSGAVSHQYVSKPAVAISAAPAIAKVATYVAPAVGH 920
            ...|    .||.||....|:|.||.:|. |.||.......:|:            .||.||..|:
  Fly   143 NGNGGRPSSSYGAPGQGQGNGNGGRSSS-SYGAPGGGNGGRPS------------DTYGAPGGGN 194

  Fly   921 ILGGHAVGSVPVLSTKLATGYGGSGSGYSSGAVSHQYVSKPAVAISAAPAIAKVAVPTVSHISTG 985
              ||           :.:..||..|.|.:.|..|..|         .||.......|:.::.:.|
  Fly   195 --GG-----------RPSDTYGAPGGGNNGGRPSSSY---------GAPGGGNGGRPSDTYGAPG 237

  Fly   986 PSTPLGVG----VGYGSSGHG-GVLLGAPLTKLTSAPAY-ALGGKLASSTAYGIQAGNLGHGSGP 1044
            .....|.|    ..||:.|.| |...|.|      :.:| |.|.....|.:||......|:|..|
  Fly   238 GGNGNGSGGRPSSSYGAPGQGQGGFGGRP------SDSYGAPGQNQKPSDSYGAPGSGNGNGGRP 296

  Fly  1045 SGGYYGAISLGHAKVSPALSYHGLLSHGSGLASGASSLAHLDSSLSGYSHGVGGIGPLGAGFYRY 1109
            |.. |||...|... .|:.|| |..:.|||                  :.|.||.||.||.:...
  Fly   297 SSS-YGAPGSGPGG-RPSDSY-GPPASGSG------------------AGGAGGSGPGGADYDND 340

  Fly  1110 APSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQK 1174
            .|:                                          :|.|.|.|.|..:|.:....
  Fly   341 EPA------------------------------------------KYEFNYQVEDAPSGLSFGHS 363

  Fly  1175 EERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212
            |.||||...|:|:::.|||..:.|:|.|| :.|:..::
  Fly   364 EMRDGDFTTGQYNVLLPDGRKQIVEYEAD-QQGYRPQI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 20/51 (39%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.