DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr51A

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:80 Identity:25/80 - (31%)
Similarity:41/80 - (51%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1126 AYLKSAPVTQHAVLKVVPEKHLEHF-DAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLV 1189
            |...:||..|.:..:.:..:..|.: :.:.:|:|..:|:|........:.|||:|..|:|.||..
  Fly    13 ALCMAAPPRQESEAERIEREEYEKYQNENAQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF 77

  Fly  1190 EPDGNV-RTVKYYAD 1203
              ||.| |.|:|.||
  Fly    78 --DGFVKRRVEYIAD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 20/49 (41%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:459790 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.