DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr50Cb

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:165 Identity:53/165 - (32%)
Similarity:76/165 - (46%) Gaps:32/165 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 ISLGHAKVSPALSYHGLLSHGSGLASGASSLAHLDSSLSGYSHGVGGI----GPLGAGFYRYAPS 1112
            :||..|.:| |.:|       :.:|.|::  |:|..:.:||.:.....    ||.|      .|:
  Fly    10 LSLSLAAIS-AYAY-------AQIAPGSN--AYLPPTKNGYDYSEPKTPFKPGPPG------RPA 58

  Fly  1113 VPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEER 1177
            .|.....||......:...|...|..:..:|            |.|||||.||.|.::...|...
  Fly    59 APGPRPPAPPGTPRNIPGQPGDDHVHVPGMP------------YDFEYAVQDPETANDYAHKASS 111

  Fly  1178 DGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212
            |||||.|||.:..|||..:.|:|.|||:||:||:|
  Fly   112 DGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 27/51 (53%)
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.