DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr30B

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:75 Identity:34/75 - (45%)
Similarity:43/75 - (57%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1156 YAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEVINSRDQGK 1220
            |.|:::||||||||.|.|||.|..|.|:|.|.|::.||..|.|:|.||...||.|          
  Fly    33 YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEA---------- 87

  Fly  1221 IVAKRQTETK 1230
            ||.:..|:.|
  Fly    88 IVQREPTDIK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 27/51 (53%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 27/51 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.