DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr23B

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:228 Identity:72/228 - (31%)
Similarity:93/228 - (40%) Gaps:56/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1014 TSAPAYALGGKLASSTAYGIQAGNLGHGSG---------PSGGYYG--AISLGHAKVSPALSYHG 1067
            ||...|....|.|       :|.|....||         ||.....  |...|:..|:||.:...
  Fly    16 TSQAEYNYNEKEA-------KAANSASSSGEDFLSDYHTPSNNALNSEATPDGYDYVAPARNQFT 73

  Fly  1068 LLS-----HGSGLASGASSLAHLDSSLSGYSHGVGGIGPLGAGFYRYAPS-VPAL---SSHAPVA 1123
            ..|     ..|.|...|:|.|:.:|.|                    .|| :|.|   .:...|:
  Fly    74 AGSRTASVQASNLLQNAASAANAESVL--------------------LPSPLPVLRHEQNSEVVS 118

  Fly  1124 ATAYLKSAPVTQH-----AVLKVVPEKHLEHFDAHP--RYAFEYAVNDPHTGDNKHQKEERDGDV 1181
            :|...:.....||     .|:..|..:|.|. :..|  .|:|.|||||..|||.|...|.|||.|
  Fly   119 STQQQQEQQTVQHQQSEPLVVSSVLRQHQEP-EVFPPASYSFNYAVNDASTGDIKEHSETRDGYV 182

  Fly  1182 VKGEYSLVEPDGNVRTVKYYADWETGFHAEVIN 1214
            |:|.|||::|||..|||.|.||...||:| |:|
  Fly   183 VRGFYSLIDPDGYKRTVTYTADDVHGFNA-VVN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 30/51 (59%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 30/51 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.