DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr66D

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:XP_556966.3 Gene:Cpr66D / 3290137 VectorBaseID:AGAMI1_014268 Length:256 Species:Anopheles gambiae


Alignment Length:84 Identity:39/84 - (46%)
Similarity:54/84 - (64%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1144 EKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGF 1208
            |:..|.:||:|.|.|.:.|.|....:.:::||:|||:|:||.||:|:.||.:|||.|.||.:.||
Mosquito   130 EEEQEDYDANPSYQFGFDVKDDEFTNYQNRKEQRDGNVIKGSYSVVDSDGFIRTVTYTADPKEGF 194

  Fly  1209 HAEVINSRDQGKIVAKRQT 1227
            .|||  ||....||.|..|
Mosquito   195 KAEV--SRQPTDIVVKIPT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 23/51 (45%)
Cpr66DXP_556966.3 Chitin_bind_4 142..194 CDD:459790 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.