DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and LOC3290078

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:XP_556645.2 Gene:LOC3290078 / 3290078 VectorBaseID:AGAMI1_011744 Length:141 Species:Anopheles gambiae


Alignment Length:173 Identity:56/173 - (32%)
Similarity:73/173 - (42%) Gaps:59/173 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 ISLGHAKVSPALSYHGLLSH----------GSGLASGASSLAHLDSSLSGYSHGVGGIGPLGAGF 1106
            :||....|:.|..:||.:|.          |.|...|            |:..|:|| |..|...
Mosquito     7 VSLALVGVALAYEHHGFVSEVKHIPYKYFGGIGGEQG------------GFEGGIGG-GISGGSE 58

  Fly  1107 YRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNK 1171
            ..|..                                    :.:.|:|:|.|||.|.|.||||:|
Mosquito    59 GGYEG------------------------------------KDYYAYPKYKFEYGVKDYHTGDHK 87

  Fly  1172 HQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEVIN 1214
            .|.|.||||||||||::.||||::..|||:||.:.||.|.|.|
Mosquito    88 SQWEVRDGDVVKGEYTVQEPDGSMSVVKYHADGKNGFEAIVKN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 32/51 (63%)
LOC3290078XP_556645.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.