DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and CG11585

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster


Alignment Length:399 Identity:137/399 - (34%)
Similarity:193/399 - (48%) Gaps:87/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IEIKNLVSPAV-TKLDNSYLPPSPGITKVATYTSPGYSYSSASPGISKVATYSSPSLSSVPYYAP 206
            |.|.:|.|..: |.|.|:||||..|       ...|||.:::|              ||..|.||
  Fly     6 ILILSLASVGLATPLSNTYLPPKVG-------AQSGYSAAASS--------------SSGSYAAP 49

  Fly   207 PVTSKVETYSSPAYTYSKTTPGYSKVETYSSPGYSYGQISPGISRIATYSPS-------VSYSAP 264
            ..|....::|..|.:.....|. |...:|||.|.||.  :|.:|.::..:|:       ||||||
  Fly    50 AATYARRSHSVAAPSRQYLAPA-SSHGSYSSGGSSYA--APSVSHVSYSAPAASASASHVSYSAP 111

  Fly   265 TIAKVSTYSAPSVKLATTSSLLSSHGTGYSASYAPSITKYSQVSDVSHQYISKPIVA----AYPA 325
            ..|. |:|:||||   :..|..|:..|.|||..|....||...:.|||...|.|:|:    :.||
  Fly   112 AAAH-SSYAAPSV---SHGSYSSASRTSYSAPVAAPSRKYLAPAAVSHSSYSAPVVSRKSYSAPA 172

  Fly   326 ITKVAASYGGTASGALSHQYVSQPAIAKVSTYAAPTVATYSSGPAISKLSTSYGASGSGAVSHQY 390
            ::..:.|..|.:||                :|:|| ||:|||..|.:...|||.|. ..|.|.||
  Fly   173 VSHGSYSSSGGSSG----------------SYSAP-VASYSSYSAPAASHTSYSAP-VAAPSRQY 219

  Fly   391 VSKPAVAIAAPAVAKVATYAAPAISSYSTGPAISKVASYAAPTVSTYSSGYGYGSSGSGAVSHQY 455
            ::..|.:.:|||   |::|:|||:|||| .||:|   ||:||.|| :.|.|...|...|:.    
  Fly   220 LAPAASSYSAPA---VSSYSAPAVSSYS-APAVS---SYSAPAVS-HGSSYSTSSLSHGSY---- 272

  Fly   456 VSKPAVAISAAPAIAKVATYAAPAIS--TYAAAPVVTKVATGYG-GSGSGYSSGAVSHQYVSKPA 517
                     |||:::. .||||||:|  :|:.    :...:|:| ||||.:.||..|....|..:
  Fly   273 ---------AAPSVSS-KTYAAPAVSHGSYSG----SSSGSGHGYGSGSSHGSGVRSGHGSSFGS 323

  Fly   518 VAKVATYAA 526
            ..|..:|||
  Fly   324 GHKSGSYAA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 55/148 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.