DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and CG1368

DIOPT Version :9

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster


Alignment Length:218 Identity:75/218 - (34%)
Similarity:108/218 - (49%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NKYIAPVQKSLFSPSAEYGGAGI--TYADKSPAAKYATVVPSGIEIKNLVSPAVTKLDNSYLPPS 164
            |:|:.|||.|..:||..|....:  |||  :||.:.:.|.||                |.|||| 
  Fly    22 NEYLPPVQSSYAAPSVSYSAPAVQQTYA--APAIQQSYVAPS----------------NEYLPP- 67

  Fly   165 PGITKVATYTSPGYSYSSASPGISKVATYSSPSLSSVPYYAPPVTSKVETYSSPAYTYSKTTPGY 229
                 |.||::|....:.::|.:.:  |||:||:|   |.||.|     :||:|:.:||  .|..
  Fly    68 -----VQTYSAPAVQRTYSAPAVQR--TYSAPSVS---YSAPSV-----SYSAPSVSYS--APAV 115

  Fly   230 SKVETYSSPGYSYGQISPGISRIATYS-PSVSYSAPTIAKVSTYSAPSVKLATTSSLLSSHGTGY 293
            .  ::||:|..||.  :|.:.:  :|| ||||||||.:.:  :||||:|..:..|       ..|
  Fly   116 Q--QSYSAPSVSYS--APAVQQ--SYSAPSVSYSAPAVQQ--SYSAPAVSYSAPS-------VSY 165

  Fly   294 SASYAPSITKYSQVSDVSHQYIS 316
            |   |||:       ||..||.|
  Fly   166 S---APSV-------DVGTQYAS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 69/201 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.