DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr30F

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:138 Identity:46/138 - (33%)
Similarity:63/138 - (45%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1095 GVGGIGPLGAGFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFE 1159
            |||....:....|           |:|.|....|          ||.|..:...|:|      |.
  Fly    11 GVGAAAAIELPIY-----------HSPAAIVKPL----------LKTVEVEAPAHYD------FA 48

  Fly  1160 YAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHA---------EVINS 1215
            |:|:|.||||.|.|.|.|.||.|:|:|:||:.||.:|||.|.:|...||:|         :||.:
  Fly    49 YSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPLGQKVIKA 113

  Fly  1216 RDQGKIVA 1223
            ....|::|
  Fly   114 APIAKLLA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 26/51 (51%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 27/57 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.