DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bd and Cpr31A

DIOPT Version :10

Sequence 1:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:223 Identity:71/223 - (31%)
Similarity:96/223 - (43%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1021 LGGKLAS-----STAYGIQAGNLGHGSGPSGGYYGAISLGHAKVSPALSYHGLLSHGSGLASGAS 1080
            :.|||.:     :.|...:||    .:....||:.|.:...|   ||..||         |:..:
  Fly     1 MAGKLLTVFSLLAIAASCRAG----FAATYAGYHPAYATYQA---PAAVYH---------AAPVA 49

  Fly  1081 SLAHLDSSLSGYSHGVGGIGPLGAGFY--------RYAPSVPALSSHAPVAATAYLKSAPVTQHA 1137
            ..|....:...|:.......|:....|        ..||:..||...|||..|  |.:|||....
  Fly    50 QAAVYQQAAPVYAKTFVPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKT--LAAAPVVAAP 112

  Fly  1138 VLKVVPE-----KHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRT 1197
            |:|.|..     |.:| .::.|||.|.|.|:|..|||.|.|.|.|||..|.|.||:::.||..||
  Fly   113 VVKTVAAAPAVLKQVE-LESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRT 176

  Fly  1198 VKYYADWETGFHAEVINSRDQGKIVAKR 1225
            |.|.||...||:|.|    .:..:||.|
  Fly   177 VTYTADDINGFNAVV----QREPVVAAR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 26/51 (51%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:459790 26/51 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.