DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr100A

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:262 Identity:59/262 - (22%)
Similarity:86/262 - (32%) Gaps:85/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ESRDGDGVK-GHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQ 138
            |..|.||.: |.||.|:|.|..||:.||| .|.||.|      :..| :.::|....|.......
  Fly    55 EETDADGTRHGSYSYLDPTGQRRTISYTA-GKNGFQA------SGDH-LPQAPPAPPQPVPTAGY 111

  Fly   139 SKINHYSKDQEHIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIKPHARIKQ---------VPMDMD 194
            .....|...|                    :..| .|     :|.|..:.         .|...|
  Fly   112 QPQQQYQPQQ--------------------YQAP-AP-----QPQASFRSNDYGDDGSYDPRYND 150

  Fly   195 PGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYTTGSPAHS 259
            |......|.     |:|.||.   ..|....||.|..|.       |...::|:|.|....|   
  Fly   151 PSFGQNQQS-----YQQPAAQ---PQYRPAPQPAYNPQP-------VQPQQQYQPQYQQPQP--- 197

  Fly   260 HFYDHYKPKEIPHNYIHKPSVPQQSLHTSFSPSKPRINIPESISNHIHQKKVVHTTPGLKHYKYK 324
               .:.:|:            |||:.:|:.:|:..|.:.|..:|        ::.||....|.:.
  Fly   198 ---QYQQPQ------------PQQAYYTTTTPNPHRFSPPGKLS--------LNRTPDGFTYSFN 239

  Fly   325 GV 326
            .|
  Fly   240 KV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 16/33 (48%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:278791 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.