DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr92A

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:265 Identity:72/265 - (27%)
Similarity:100/265 - (37%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKG 84
            |..|.|..|.:..:|             .|:.....|:|.|.::|.:|||:|||.|:|.||.|||
  Fly    45 GPLPGPYVAPKPAAP-------------EPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKG 96

  Fly    85 HYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQSKINHYSKDQE 149
            .|||::|||:.|||.||||...||||:|:     ..|:.                     .|...
  Fly    97 SYSVVDPDGTKRTVDYTADPHHGFNAVVR-----KEPLA---------------------YKAPA 135

  Fly   150 HIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIKPHARIKQVPMDMDPGIRDRLQQARDTYYKQIAA 214
            |  |:..:.|...|:.  .|..|.....:...|.|.:...|:.:.|            |::...|
  Fly   136 H--LAPVVAPAPAPVP--AHYGPAPAPPLPPVPKAPLLSYPLALGP------------YHRGAPA 184

  Fly   215 AHKLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYTTGSPAHSHF-YDHY-------KPKEIP 271
            .......:....|.         :|.|..|.....|:....||.:|. |.||       .|.| |
  Fly   185 PAPGPAPAPAPAPV---------SVPVATPVLPSAHFHAAYPALAHSPYAHYPAPGPAPAPVE-P 239

  Fly   272 HNYIH 276
            |.|.|
  Fly   240 HAYYH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 30/51 (59%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 9/44 (20%)
Chitin_bind_4 68..120 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.