DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:248 Identity:66/248 - (26%)
Similarity:97/248 - (39%) Gaps:70/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PIGAVRGGSPVVVIDE--DDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYS 87
            |..|....:||.|..:  .....||.||.:   |.|||||.|..|||.|.|.|.||||.|:|.||
  Fly    32 PAVATYAHAPVAVAQKVVVKAAEEYDPHPQ---YRFSYGVDDKLTGDNKGQVEERDGDVVRGEYS 93

  Fly    88 VLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIV 152
            :::.||..|||.||||...||||:|     |..|:.::                         :.
  Fly    94 LIDADGYKRTVQYTADPINGFNAVV-----NREPLVKA-------------------------VA 128

  Fly   153 LSSDIKPLKRPIEDLTH---SHPKVPSLIE-IKPHAR------IKQVPMDMDPGIRDRLQQARDT 207
            ::..:|.:..|:.....   :|...|:::: :.|.|.      :|.|              |...
  Fly   129 VAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTV--------------APVA 179

  Fly   208 YYKQIAAAHKLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYTTGSPAHSH 260
            :|...||      |:....||:......:.|     |......|:..:.|:.|
  Fly   180 HYAAPAA------YATYAAPTHYAAPAHYAA-----PAATYTSYSAPAVAYHH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 30/51 (59%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.