DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Ccp84Ac

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:314 Identity:77/314 - (24%)
Similarity:104/314 - (33%) Gaps:153/314 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLALI--CLGTRPPPIGAVRGGSPVVVIDEDDE-----------------TMEYAPH-YE----- 52
            |:||:  ||       .||..|  ::.:::.|:                 ..|..|| :|     
  Fly     5 LVALVSCCL-------AAVSAG--LIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDD 60

  Fly    53 -HQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVG 116
             |..|.|:|.|:|..:||.|||.||||||.|:|.||:.:.||..|||.||||:..||||:|..  
  Fly    61 PHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHR-- 123

  Fly   117 ANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIK 181
                                                            |.|.|.|.||.:...::
  Fly   124 ------------------------------------------------EPLAHVHHKVVAAAPVQ 140

  Fly   182 PHARIKQVPMDMDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQ----PTYAVQEGDWKAVIVN 242
            .|                         :...|||..::.|:...|    ||||.           
  Fly   141 YH-------------------------HAPAAAAAVIKSYASPSQAYVAPTYAA----------- 169

  Fly   243 EPKEYRPHYTTGSPAHS-----------HFYDHYKPKEIP---------HNYIH 276
                  |.||  :||::           |...||...|.|         |.|.|
  Fly   170 ------PAYT--APAYATHQAEQPQEREHQQHHYASYESPAHAQAAHEGHEYYH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 29/51 (57%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.