DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:176 Identity:55/176 - (31%)
Similarity:84/176 - (47%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLALICLGTRP-------PPIGAVRGGSPVVVIDEDDETMEYAPHYE-HQGYAFSYGVKDLHTGD 69
            |:|....|..|       .|..|....:||.|........:.|..|: |..|.::|.|:|..:||
  Fly    11 LIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSLSGD 75

  Fly    70 VKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVND 134
            .|||.|.||||.|:|.||:::.||..|||.||||...||||:|     |..|:.::...:..|. 
  Fly    76 SKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVV-----NREPLVKAVAVAPVVK- 134

  Fly   135 DTSQSKINHYSKDQ-EHIVLSSDIKPLKRPIEDLTHSHPKVPSLIE 179
             |..:.:.||:... .|....:.:|.: .|:     :|...|::::
  Fly   135 -TVAAPVAHYAAPAVAHYAAPAVVKTV-APV-----AHYAAPAVVK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 27/51 (53%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.